PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g080720.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 327aa    MW: 37378.4 Da    PI: 10.0987
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g080720.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73e-294092254
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                        prlrWt+++H+rFv ave+ GG ++AtPk +l++m+vkgLt++h+kSHLQ+Y+
  Sopim02g080720.0.1 40 PRLRWTHDIHRRFVYAVERVGGVDRATPKMVLQIMDVKGLTISHIKSHLQMYK 92
                        8***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-273895IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-214093IPR006447Myb domain, plants
SuperFamilySSF466892.69E-134093IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMKGLEFSKN SPSLSMELGY SSNYKSSKFA IRAYIKSIMP RLRWTHDIHR RFVYAVERVG  60
GVDRATPKMV LQIMDVKGLT ISHIKSHLQM YKNMKHQEMQ GEAANGRKRN RIDGSDSMNI  120
PQRNLVRRHN HIKGKTAMFD GSDSINFPQR NLVDRYNHIK SKAAMFDGSD QMNFPQGNLV  180
HCYNHNNGKA PIFKGSDQMN FTQRNLVHRY NYNNGKSVFD DHLNPTVTTN YLDKIASSST  240
AFPPPWKSMP EKKMGLERRY YLFRDFFDGT ITIRDGDNDD KIVRAYGISN LPNKSATSMV  300
EEEDSHSTIS LDLSLSSYIS LDLTLG*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065507.10.0PREDICTED: uncharacterized protein LOC107010733
TrEMBLK4B9U30.0K4B9U3_SOLLC; Uncharacterized protein
STRINGSolyc02g080720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13843412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.16e-27G2-like family protein